PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_84.88
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 260aa    MW: 28822.3 Da    PI: 8.1439
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_84.88genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1318.4e-103280250
                         FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktek 50
                                 +Y+eYAk+vGF + k +s++s+ ++e+++++f C ++   +e+ ++ ++
  evm.model.supercontig_84.88 32 YYKEYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRKHAISERLDELQS 80
                                 9***********************************9998888777333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.2E-83286IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MDTSNVPVST GNTVLEPRND MEFESHEAAY SYYKEYAKSV GFGTAKLSSR RSRASKEFID  60
AKFSCIRKHA ISERLDELQS KVRRYNDLCR RAIILGEEGS LSQESYDIAL CAIREALKQC  120
AIVNNSIEND ARPSNPAIQT VCTVEEGNQC SITSKEKVSD PTKYTGTNKT PRRTEAGRDS  180
NQSSASGKGK QVPQFGVSGV GNQDGLHQME LVDMRPAQLH NVMPPQLHNI MPAMFHNVPP  240
PQFQNVAPPR HLHDNRPPH*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010655208.12e-67PREDICTED: protein FAR1-RELATED SEQUENCE 4 isoform X2
SwissprotQ6NQJ71e-40FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA5BA926e-68A5BA92_VITVI; Putative uncharacterized protein
STRINGVIT_09s0054g01830.t015e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.11e-41FAR1-related sequence 4